Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for Galaxie 21. Galaxie Lv 1 44 pts. 11,505
  2. Avatar for pvc78 22. pvc78 Lv 1 42 pts. 11,503
  3. Avatar for SaraL 23. SaraL Lv 1 40 pts. 11,486
  4. Avatar for jausmh 24. jausmh Lv 1 38 pts. 11,485
  5. Avatar for altejoh 25. altejoh Lv 1 36 pts. 11,437
  6. Avatar for actiasluna 26. actiasluna Lv 1 35 pts. 11,436
  7. Avatar for Bruno Kestemont 27. Bruno Kestemont Lv 1 33 pts. 11,423
  8. Avatar for Marvelz 28. Marvelz Lv 1 31 pts. 11,401
  9. Avatar for tarimo 29. tarimo Lv 1 30 pts. 11,354
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 28 pts. 11,311

Comments