Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for Galaxie 21. Galaxie Lv 1 44 pts. 11,505
  2. Avatar for pvc78 22. pvc78 Lv 1 42 pts. 11,503
  3. Avatar for SaraL 23. SaraL Lv 1 40 pts. 11,486
  4. Avatar for jausmh 24. jausmh Lv 1 38 pts. 11,485
  5. Avatar for altejoh 25. altejoh Lv 1 36 pts. 11,437
  6. Avatar for actiasluna 26. actiasluna Lv 1 35 pts. 11,436
  7. Avatar for Bruno Kestemont 27. Bruno Kestemont Lv 1 33 pts. 11,423
  8. Avatar for Marvelz 28. Marvelz Lv 1 31 pts. 11,401
  9. Avatar for tarimo 29. tarimo Lv 1 30 pts. 11,354
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 28 pts. 11,311

Comments