Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061
  1. Avatar for Galaxie 21. Galaxie Lv 1 44 pts. 11,505
  2. Avatar for pvc78 22. pvc78 Lv 1 42 pts. 11,503
  3. Avatar for SaraL 23. SaraL Lv 1 40 pts. 11,486
  4. Avatar for jausmh 24. jausmh Lv 1 38 pts. 11,485
  5. Avatar for altejoh 25. altejoh Lv 1 36 pts. 11,437
  6. Avatar for actiasluna 26. actiasluna Lv 1 35 pts. 11,436
  7. Avatar for Bruno Kestemont 27. Bruno Kestemont Lv 1 33 pts. 11,423
  8. Avatar for Marvelz 28. Marvelz Lv 1 31 pts. 11,401
  9. Avatar for tarimo 29. tarimo Lv 1 30 pts. 11,354
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 28 pts. 11,311

Comments