Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for marsfan 31. marsfan Lv 1 27 pts. 11,305
  2. Avatar for alwen 32. alwen Lv 1 26 pts. 11,295
  3. Avatar for jobo0502 33. jobo0502 Lv 1 25 pts. 11,270
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 23 pts. 11,267
  5. Avatar for Skippysk8s 35. Skippysk8s Lv 1 22 pts. 11,244
  6. Avatar for ViJay7019 36. ViJay7019 Lv 1 21 pts. 11,243
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 20 pts. 11,239
  8. Avatar for SWR_DMaster 38. SWR_DMaster Lv 1 19 pts. 11,230
  9. Avatar for ManVsYard 39. ManVsYard Lv 1 18 pts. 11,224
  10. Avatar for Vinara 40. Vinara Lv 1 17 pts. 11,223

Comments