Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for marsfan 31. marsfan Lv 1 27 pts. 11,305
  2. Avatar for alwen 32. alwen Lv 1 26 pts. 11,295
  3. Avatar for jobo0502 33. jobo0502 Lv 1 25 pts. 11,270
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 23 pts. 11,267
  5. Avatar for Skippysk8s 35. Skippysk8s Lv 1 22 pts. 11,244
  6. Avatar for ViJay7019 36. ViJay7019 Lv 1 21 pts. 11,243
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 20 pts. 11,239
  8. Avatar for SWR_DMaster 38. SWR_DMaster Lv 1 19 pts. 11,230
  9. Avatar for ManVsYard 39. ManVsYard Lv 1 18 pts. 11,224
  10. Avatar for Vinara 40. Vinara Lv 1 17 pts. 11,223

Comments