Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061
  1. Avatar for marsfan 31. marsfan Lv 1 27 pts. 11,305
  2. Avatar for alwen 32. alwen Lv 1 26 pts. 11,295
  3. Avatar for jobo0502 33. jobo0502 Lv 1 25 pts. 11,270
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 23 pts. 11,267
  5. Avatar for Skippysk8s 35. Skippysk8s Lv 1 22 pts. 11,244
  6. Avatar for ViJay7019 36. ViJay7019 Lv 1 21 pts. 11,243
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 20 pts. 11,239
  8. Avatar for SWR_DMaster 38. SWR_DMaster Lv 1 19 pts. 11,230
  9. Avatar for ManVsYard 39. ManVsYard Lv 1 18 pts. 11,224
  10. Avatar for Vinara 40. Vinara Lv 1 17 pts. 11,223

Comments