Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075

  1. Avatar for pfeiffelfloyd 71. pfeiffelfloyd Lv 1 3 pts. 10,597
  2. Avatar for Merf 72. Merf Lv 1 2 pts. 10,573
  3. Avatar for ourtown 73. ourtown Lv 1 2 pts. 10,546
  4. Avatar for lconor 74. lconor Lv 1 2 pts. 10,531
  5. Avatar for multaq 75. multaq Lv 1 2 pts. 10,503
  6. Avatar for frostschutz 76. frostschutz Lv 1 2 pts. 10,497
  7. Avatar for Psych0Active 77. Psych0Active Lv 1 2 pts. 10,490
  8. Avatar for rinze 78. rinze Lv 1 2 pts. 10,451
  9. Avatar for Deleted player 79. Deleted player pts. 10,449
  10. Avatar for silent gene 80. silent gene Lv 1 1 pt. 10,443

Comments