Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,700
  2. Avatar for Go Science 2. Go Science 71 pts. 11,691
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 11,672
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 11,669
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 11,664
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,607
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 11,550
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 11,523
  9. Avatar for Contenders 9. Contenders 3 pts. 11,518
  10. Avatar for Team China 10. Team China 2 pts. 11,061
  1. Avatar for pfeiffelfloyd 71. pfeiffelfloyd Lv 1 3 pts. 10,597
  2. Avatar for Merf 72. Merf Lv 1 2 pts. 10,573
  3. Avatar for ourtown 73. ourtown Lv 1 2 pts. 10,546
  4. Avatar for lconor 74. lconor Lv 1 2 pts. 10,531
  5. Avatar for multaq 75. multaq Lv 1 2 pts. 10,503
  6. Avatar for frostschutz 76. frostschutz Lv 1 2 pts. 10,497
  7. Avatar for Psych0Active 77. Psych0Active Lv 1 2 pts. 10,490
  8. Avatar for rinze 78. rinze Lv 1 2 pts. 10,451
  9. Avatar for Deleted player 79. Deleted player pts. 10,449
  10. Avatar for silent gene 80. silent gene Lv 1 1 pt. 10,443

Comments