Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups


  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075

  1. Avatar for Deleted player 81. Deleted player pts. 10,431
  2. Avatar for frezae 82. frezae Lv 1 1 pt. 10,429
  3. Avatar for atlas100 83. atlas100 Lv 1 1 pt. 10,405
  4. Avatar for Arne Heessels 84. Arne Heessels Lv 1 1 pt. 10,348
  5. Avatar for rosado6135 86. rosado6135 Lv 1 1 pt. 10,321
  6. Avatar for abiogenesis 87. abiogenesis Lv 1 1 pt. 10,303
  7. Avatar for rabamino12358 88. rabamino12358 Lv 1 1 pt. 10,291
  8. Avatar for m9710797 89. m9710797 Lv 1 1 pt. 10,281
  9. Avatar for NotJim99 90. NotJim99 Lv 1 1 pt. 10,269

Comments