Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for dam_01 91. dam_01 Lv 1 2 pts. 9,756
  2. Avatar for jamiexq 92. jamiexq Lv 1 2 pts. 9,724
  3. Avatar for martinf 93. martinf Lv 1 2 pts. 9,721
  4. Avatar for multaq 94. multaq Lv 1 1 pt. 9,720
  5. Avatar for pfeiffelfloyd 95. pfeiffelfloyd Lv 1 1 pt. 9,717
  6. Avatar for rabamino12358 96. rabamino12358 Lv 1 1 pt. 9,705
  7. Avatar for Vincera 97. Vincera Lv 1 1 pt. 9,704
  8. Avatar for 19477619_Schutte 98. 19477619_Schutte Lv 1 1 pt. 9,697
  9. Avatar for Psych0Active 99. Psych0Active Lv 1 1 pt. 9,685
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 9,646

Comments