Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Beta Folders 100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797

  1. Avatar for dam_01 91. dam_01 Lv 1 2 pts. 9,756
  2. Avatar for jamiexq 92. jamiexq Lv 1 2 pts. 9,724
  3. Avatar for martinf 93. martinf Lv 1 2 pts. 9,721
  4. Avatar for multaq 94. multaq Lv 1 1 pt. 9,720
  5. Avatar for pfeiffelfloyd 95. pfeiffelfloyd Lv 1 1 pt. 9,717
  6. Avatar for rabamino12358 96. rabamino12358 Lv 1 1 pt. 9,705
  7. Avatar for Vincera 97. Vincera Lv 1 1 pt. 9,704
  8. Avatar for 19477619_Schutte 98. 19477619_Schutte Lv 1 1 pt. 9,697
  9. Avatar for Psych0Active 99. Psych0Active Lv 1 1 pt. 9,685
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 9,646

Comments