Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Deleted group 12. Deleted group pts. 9,697
  2. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  3. Avatar for freefolder 14. freefolder 1 pt. 9,580
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  5. Avatar for Deleted group 16. Deleted group pts. 9,445
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426

  1. Avatar for Altercomp 111. Altercomp Lv 1 1 pt. 9,580
  2. Avatar for JMStiffler 112. JMStiffler Lv 1 1 pt. 9,576
  3. Avatar for Tmoka85 113. Tmoka85 Lv 1 1 pt. 9,564
  4. Avatar for AcidTrace 114. AcidTrace Lv 1 1 pt. 9,557
  5. Avatar for Kalimo 203 115. Kalimo 203 Lv 1 1 pt. 9,548
  6. Avatar for gask09 116. gask09 Lv 1 1 pt. 9,526
  7. Avatar for larry25427 117. larry25427 Lv 1 1 pt. 9,518
  8. Avatar for NotJim99 118. NotJim99 Lv 1 1 pt. 9,509
  9. Avatar for LostLogia4 119. LostLogia4 Lv 1 1 pt. 9,496
  10. Avatar for aspadistra 120. aspadistra Lv 1 1 pt. 9,491

Comments