Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797
  1. Avatar for Altercomp 111. Altercomp Lv 1 1 pt. 9,580
  2. Avatar for JMStiffler 112. JMStiffler Lv 1 1 pt. 9,576
  3. Avatar for Tmoka85 113. Tmoka85 Lv 1 1 pt. 9,564
  4. Avatar for AcidTrace 114. AcidTrace Lv 1 1 pt. 9,557
  5. Avatar for Kalimo 203 115. Kalimo 203 Lv 1 1 pt. 9,548
  6. Avatar for gask09 116. gask09 Lv 1 1 pt. 9,526
  7. Avatar for larry25427 117. larry25427 Lv 1 1 pt. 9,518
  8. Avatar for NotJim99 118. NotJim99 Lv 1 1 pt. 9,509
  9. Avatar for LostLogia4 119. LostLogia4 Lv 1 1 pt. 9,496
  10. Avatar for aspadistra 120. aspadistra Lv 1 1 pt. 9,491

Comments