Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,793
  2. Avatar for Deleted group 12. Deleted group pts. 9,697
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  4. Avatar for freefolder 14. freefolder 1 pt. 9,580
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  6. Avatar for Deleted group 16. Deleted group pts. 9,445
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426
  1. Avatar for weitzen 31. weitzen Lv 1 34 pts. 10,156
  2. Avatar for eusair 32. eusair Lv 1 33 pts. 10,155
  3. Avatar for Timo van der Laan 33. Timo van der Laan Lv 1 32 pts. 10,153
  4. Avatar for diamonddays 34. diamonddays Lv 1 30 pts. 10,145
  5. Avatar for Alistair69 35. Alistair69 Lv 1 29 pts. 10,136
  6. Avatar for carsonfb 36. carsonfb Lv 1 28 pts. 10,134
  7. Avatar for fiendish_ghoul 37. fiendish_ghoul Lv 1 27 pts. 10,133
  8. Avatar for drjr 38. drjr Lv 1 26 pts. 10,133
  9. Avatar for TastyMunchies 39. TastyMunchies Lv 1 25 pts. 10,132
  10. Avatar for DoctorSockrates 40. DoctorSockrates Lv 1 24 pts. 10,131

Comments