Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,793
  2. Avatar for Deleted group 12. Deleted group pts. 9,697
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,609
  4. Avatar for freefolder 14. freefolder 1 pt. 9,580
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,491
  6. Avatar for Deleted group 16. Deleted group pts. 9,445
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 9,426
  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 15 pts. 10,075
  2. Avatar for phi16 52. phi16 Lv 1 14 pts. 10,072
  3. Avatar for MicElephant 53. MicElephant Lv 1 13 pts. 10,072
  4. Avatar for Glen B 54. Glen B Lv 1 13 pts. 10,070
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 10,070
  6. Avatar for dbuske 56. dbuske Lv 1 11 pts. 10,047
  7. Avatar for cbwest 57. cbwest Lv 1 11 pts. 10,046
  8. Avatar for alcor29 58. alcor29 Lv 1 10 pts. 10,029
  9. Avatar for cobaltteal 59. cobaltteal Lv 1 10 pts. 10,016
  10. Avatar for Vinara 60. Vinara Lv 1 9 pts. 10,016

Comments