Placeholder image of a protein
Icon representing a puzzle

1523: Revisiting Puzzle 66: Cytochrome

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 21, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,280
  2. Avatar for Go Science 2. Go Science 73 pts. 10,258
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,251
  4. Avatar for Contenders 4. Contenders 36 pts. 10,221
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 10,217
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,202
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 10,198
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,197
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,167
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,797
  1. Avatar for Knoblerine 131. Knoblerine Lv 1 1 pt. 9,415
  2. Avatar for ManVsYard 132. ManVsYard Lv 1 1 pt. 9,411
  3. Avatar for Anamfija 133. Anamfija Lv 1 1 pt. 9,333
  4. Avatar for Pibeagles 134. Pibeagles Lv 1 1 pt. 9,321
  5. Avatar for DipsyDoodle2016 135. DipsyDoodle2016 Lv 1 1 pt. 9,307
  6. Avatar for Gahmeir 136. Gahmeir Lv 1 1 pt. 9,287
  7. Avatar for Unfunnee 137. Unfunnee Lv 1 1 pt. 9,284
  8. Avatar for crazyman4865 138. crazyman4865 Lv 1 1 pt. 9,280
  9. Avatar for west.elsdon 139. west.elsdon Lv 1 1 pt. 9,202
  10. Avatar for MENGYUN 140. MENGYUN Lv 1 1 pt. 9,103

Comments