Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for nellasdim 111. nellasdim Lv 1 1 pt. 8,257
  2. Avatar for Ladybug_dk 112. Ladybug_dk Lv 1 1 pt. 8,232
  3. Avatar for JasperD 113. JasperD Lv 1 1 pt. 8,179
  4. Avatar for gstelle 114. gstelle Lv 1 1 pt. 8,174
  5. Avatar for wouterenkinga 115. wouterenkinga Lv 1 1 pt. 8,048
  6. Avatar for Voltozan 116. Voltozan Lv 1 1 pt. 8,047
  7. Avatar for pfeiffelfloyd 117. pfeiffelfloyd Lv 1 1 pt. 7,906
  8. Avatar for alyssa_d 118. alyssa_d Lv 1 1 pt. 7,767
  9. Avatar for kkaaggii 119. kkaaggii Lv 1 1 pt. 7,630
  10. Avatar for Ancypal 120. Ancypal Lv 1 1 pt. 7,602

Comments