Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups


  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0

  1. Avatar for Tehnologik1 141. Tehnologik1 Lv 1 1 pt. 446
  2. Avatar for JMStiffler 142. JMStiffler Lv 1 1 pt. 0
  3. Avatar for Katherinelkx 143. Katherinelkx Lv 1 1 pt. 0
  4. Avatar for Dustmote091 144. Dustmote091 Lv 1 1 pt. 0
  5. Avatar for ivalnic 145. ivalnic Lv 1 1 pt. 0
  6. Avatar for Kevin76 146. Kevin76 Lv 1 1 pt. 0
  7. Avatar for kitek314_pl 147. kitek314_pl Lv 1 1 pt. 0
  8. Avatar for joshmiller 148. joshmiller Lv 1 1 pt. 0
  9. Avatar for Marvelz 149. Marvelz Lv 1 1 pt. 0

Comments