Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 52 pts. 9,769
  2. Avatar for Mike Cassidy 22. Mike Cassidy Lv 1 50 pts. 9,764
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 48 pts. 9,756
  4. Avatar for Glen B 24. Glen B Lv 1 47 pts. 9,738
  5. Avatar for Steven Pletsch 25. Steven Pletsch Lv 1 45 pts. 9,733
  6. Avatar for christioanchauvin 26. christioanchauvin Lv 1 43 pts. 9,710
  7. Avatar for DoctorSockrates 27. DoctorSockrates Lv 1 42 pts. 9,707
  8. Avatar for nicobul 28. nicobul Lv 1 40 pts. 9,693
  9. Avatar for Skippysk8s 29. Skippysk8s Lv 1 39 pts. 9,683
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 37 pts. 9,666

Comments