Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for sciencewalker 81. sciencewalker Lv 1 4 pts. 8,943
  2. Avatar for momadoc 82. momadoc Lv 1 3 pts. 8,943
  3. Avatar for tomespen 83. tomespen Lv 1 3 pts. 8,936
  4. Avatar for Deleted player 84. Deleted player pts. 8,920
  5. Avatar for Superphosphate 85. Superphosphate Lv 1 3 pts. 8,883
  6. Avatar for Vincera 86. Vincera Lv 1 3 pts. 8,881
  7. Avatar for MsHsi 87. MsHsi Lv 1 3 pts. 8,858
  8. Avatar for SaraL 88. SaraL Lv 1 2 pts. 8,856
  9. Avatar for ManVsYard 89. ManVsYard Lv 1 2 pts. 8,854
  10. Avatar for rinze 90. rinze Lv 1 2 pts. 8,844

Comments