Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Team China 16. Team China 1 pt. 9,603
  6. Avatar for Deleted group 17. Deleted group pts. 9,517
  7. Avatar for freefolder 18. freefolder 1 pt. 9,405
  8. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  9. Avatar for Russian team 20. Russian team 1 pt. 9,236

  1. Avatar for Threeoak 91. Threeoak Lv 1 2 pts. 9,758
  2. Avatar for drjr 92. drjr Lv 1 1 pt. 9,742
  3. Avatar for Arne Heessels 93. Arne Heessels Lv 1 1 pt. 9,741
  4. Avatar for uihcv 94. uihcv Lv 1 1 pt. 9,721
  5. Avatar for Savas 95. Savas Lv 1 1 pt. 9,718
  6. Avatar for GaryForbis 96. GaryForbis Lv 1 1 pt. 9,711
  7. Avatar for pandapharmd 97. pandapharmd Lv 1 1 pt. 9,702
  8. Avatar for severin333 98. severin333 Lv 1 1 pt. 9,690
  9. Avatar for nathanmills 99. nathanmills Lv 1 1 pt. 9,682
  10. Avatar for ourtown 100. ourtown Lv 1 1 pt. 9,668

Comments