Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Team China 16. Team China 1 pt. 9,603
  6. Avatar for Deleted group 17. Deleted group pts. 9,517
  7. Avatar for freefolder 18. freefolder 1 pt. 9,405
  8. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  9. Avatar for Russian team 20. Russian team 1 pt. 9,236

  1. Avatar for Ribo-soma 151. Ribo-soma Lv 1 1 pt. 2,966
  2. Avatar for Sydefecks 152. Sydefecks Lv 1 1 pt. 2,966

Comments