Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Team China 16. Team China 1 pt. 9,603
  6. Avatar for Deleted group 17. Deleted group pts. 9,517
  7. Avatar for freefolder 18. freefolder 1 pt. 9,405
  8. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  9. Avatar for Russian team 20. Russian team 1 pt. 9,236

  1. Avatar for nicobul 21. nicobul Lv 1 50 pts. 10,331
  2. Avatar for johnmitch 22. johnmitch Lv 1 48 pts. 10,328
  3. Avatar for hpaege 23. hpaege Lv 1 46 pts. 10,327
  4. Avatar for frood66 24. frood66 Lv 1 44 pts. 10,326
  5. Avatar for Norrjane 25. Norrjane Lv 1 43 pts. 10,308
  6. Avatar for fiendish_ghoul 26. fiendish_ghoul Lv 1 41 pts. 10,306
  7. Avatar for Blipperman 27. Blipperman Lv 1 39 pts. 10,306
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 38 pts. 10,300
  9. Avatar for actiasluna 29. actiasluna Lv 1 36 pts. 10,297
  10. Avatar for O Seki To 30. O Seki To Lv 1 35 pts. 10,296

Comments