Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 9,682
  6. Avatar for Team China 16. Team China 1 pt. 9,603
  7. Avatar for Deleted group 17. Deleted group pts. 9,517
  8. Avatar for freefolder 18. freefolder 1 pt. 9,405
  9. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  10. Avatar for Russian team 20. Russian team 1 pt. 9,236
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 22 pts. 10,215
  2. Avatar for toshiue 42. toshiue Lv 1 21 pts. 10,214
  3. Avatar for YeshuaLives 43. YeshuaLives Lv 1 20 pts. 10,208
  4. Avatar for stomjoh 44. stomjoh Lv 1 19 pts. 10,180
  5. Avatar for jausmh 45. jausmh Lv 1 18 pts. 10,172
  6. Avatar for diamonddays 46. diamonddays Lv 1 18 pts. 10,166
  7. Avatar for katling 47. katling Lv 1 17 pts. 10,159
  8. Avatar for manu8170 48. manu8170 Lv 1 16 pts. 10,154
  9. Avatar for Flagg65a 49. Flagg65a Lv 1 15 pts. 10,143
  10. Avatar for guineapig 50. guineapig Lv 1 15 pts. 10,130

Comments