Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Team China 16. Team China 1 pt. 9,603
  6. Avatar for Deleted group 17. Deleted group pts. 9,517
  7. Avatar for freefolder 18. freefolder 1 pt. 9,405
  8. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  9. Avatar for Russian team 20. Russian team 1 pt. 9,236

  1. Avatar for carsonfb 61. carsonfb Lv 1 8 pts. 10,079
  2. Avatar for dbuske 62. dbuske Lv 1 8 pts. 10,071
  3. Avatar for jobo0502 63. jobo0502 Lv 1 8 pts. 10,067
  4. Avatar for Deleted player 64. Deleted player pts. 10,059
  5. Avatar for Merf 65. Merf Lv 1 7 pts. 10,058
  6. Avatar for LavenderSky 66. LavenderSky Lv 1 6 pts. 10,056
  7. Avatar for Crossed Sticks 67. Crossed Sticks Lv 1 6 pts. 10,047
  8. Avatar for mitarcher 68. mitarcher Lv 1 6 pts. 10,047
  9. Avatar for Deleted player 69. Deleted player pts. 10,040
  10. Avatar for ppp6 70. ppp6 Lv 1 5 pts. 10,002

Comments