Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046
  1. Avatar for pfirth 121. pfirth Lv 1 1 pt. 9,421
  2. Avatar for Altercomp 122. Altercomp Lv 1 1 pt. 9,405
  3. Avatar for blob_folder 123. blob_folder Lv 1 1 pt. 9,333
  4. Avatar for MsHsi 124. MsHsi Lv 1 1 pt. 9,331
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 1 pt. 9,324
  6. Avatar for NotJim99 126. NotJim99 Lv 1 1 pt. 9,269
  7. Avatar for Keresto 127. Keresto Lv 1 1 pt. 9,242
  8. Avatar for Znaika 128. Znaika Lv 1 1 pt. 9,236
  9. Avatar for may of rose 129. may of rose Lv 1 1 pt. 9,212
  10. Avatar for justintwayland 130. justintwayland Lv 1 1 pt. 9,198

Comments