Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Beta Folders 100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934

  1. Avatar for pfirth 121. pfirth Lv 1 1 pt. 9,421
  2. Avatar for Altercomp 122. Altercomp Lv 1 1 pt. 9,405
  3. Avatar for blob_folder 123. blob_folder Lv 1 1 pt. 9,333
  4. Avatar for MsHsi 124. MsHsi Lv 1 1 pt. 9,331
  5. Avatar for ManVsYard 125. ManVsYard Lv 1 1 pt. 9,324
  6. Avatar for NotJim99 126. NotJim99 Lv 1 1 pt. 9,269
  7. Avatar for Keresto 127. Keresto Lv 1 1 pt. 9,242
  8. Avatar for Znaika 128. Znaika Lv 1 1 pt. 9,236
  9. Avatar for may of rose 129. may of rose Lv 1 1 pt. 9,212
  10. Avatar for justintwayland 130. justintwayland Lv 1 1 pt. 9,198

Comments