Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046
  1. Avatar for eusair 51. eusair Lv 1 14 pts. 10,128
  2. Avatar for Vinara 52. Vinara Lv 1 13 pts. 10,122
  3. Avatar for frostschutz 53. frostschutz Lv 1 13 pts. 10,121
  4. Avatar for joremen 54. joremen Lv 1 12 pts. 10,117
  5. Avatar for isaksson 55. isaksson Lv 1 11 pts. 10,106
  6. Avatar for tarimo 56. tarimo Lv 1 11 pts. 10,105
  7. Avatar for TastyMunchies 57. TastyMunchies Lv 1 10 pts. 10,095
  8. Avatar for Alistair69 58. Alistair69 Lv 1 10 pts. 10,095
  9. Avatar for rezaefar 59. rezaefar Lv 1 9 pts. 10,085
  10. Avatar for reefyrob 60. reefyrob Lv 1 9 pts. 10,082

Comments