Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Beta Folders 100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934

  1. Avatar for eusair 51. eusair Lv 1 14 pts. 10,128
  2. Avatar for Vinara 52. Vinara Lv 1 13 pts. 10,122
  3. Avatar for frostschutz 53. frostschutz Lv 1 13 pts. 10,121
  4. Avatar for joremen 54. joremen Lv 1 12 pts. 10,117
  5. Avatar for isaksson 55. isaksson Lv 1 11 pts. 10,106
  6. Avatar for tarimo 56. tarimo Lv 1 11 pts. 10,105
  7. Avatar for TastyMunchies 57. TastyMunchies Lv 1 10 pts. 10,095
  8. Avatar for Alistair69 58. Alistair69 Lv 1 10 pts. 10,095
  9. Avatar for rezaefar 59. rezaefar Lv 1 9 pts. 10,085
  10. Avatar for reefyrob 60. reefyrob Lv 1 9 pts. 10,082

Comments