Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,046
  2. Avatar for Window Group 22. Window Group 1 pt. 3,046

  1. Avatar for alcor29 71. alcor29 Lv 1 5 pts. 9,992
  2. Avatar for silent gene 72. silent gene Lv 1 5 pts. 9,991
  3. Avatar for gdnskye 73. gdnskye Lv 1 4 pts. 9,985
  4. Avatar for joaniegirl 74. joaniegirl Lv 1 4 pts. 9,978
  5. Avatar for Deleted player 75. Deleted player pts. 9,970
  6. Avatar for Glen B 76. Glen B Lv 1 4 pts. 9,950
  7. Avatar for sciencewalker 77. sciencewalker Lv 1 4 pts. 9,949
  8. Avatar for alyssa_d 78. alyssa_d Lv 1 3 pts. 9,934
  9. Avatar for atlas100 79. atlas100 Lv 1 3 pts. 9,933
  10. Avatar for Jesse Pinkman 80. Jesse Pinkman Lv 1 3 pts. 9,928

Comments