Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934
  1. Avatar for alcor29 71. alcor29 Lv 1 5 pts. 9,992
  2. Avatar for silent gene 72. silent gene Lv 1 5 pts. 9,991
  3. Avatar for gdnskye 73. gdnskye Lv 1 4 pts. 9,985
  4. Avatar for joaniegirl 74. joaniegirl Lv 1 4 pts. 9,978
  5. Avatar for Deleted player 75. Deleted player pts. 9,970
  6. Avatar for Glen B 76. Glen B Lv 1 4 pts. 9,950
  7. Avatar for sciencewalker 77. sciencewalker Lv 1 4 pts. 9,949
  8. Avatar for alyssa_d 78. alyssa_d Lv 1 3 pts. 9,934
  9. Avatar for atlas100 79. atlas100 Lv 1 3 pts. 9,933
  10. Avatar for Jesse Pinkman 80. Jesse Pinkman Lv 1 3 pts. 9,928

Comments