Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Beta Folders 100 pts. 10,478
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 10,465
  3. Avatar for Contenders 3. Contenders 61 pts. 10,461
  4. Avatar for Go Science 4. Go Science 47 pts. 10,433
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 10,423
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,373
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 19 pts. 10,331
  8. Avatar for Marvin's bunch 8. Marvin's bunch 14 pts. 10,328
  9. Avatar for HMT heritage 9. HMT heritage 10 pts. 10,296
  10. Avatar for Trinity Biology 10. Trinity Biology 7 pts. 9,934

  1. Avatar for Felix12356 141. Felix12356 Lv 1 1 pt. 8,934
  2. Avatar for 01010011111 142. 01010011111 Lv 1 1 pt. 8,931
  3. Avatar for DOCnames 143. DOCnames Lv 1 1 pt. 8,904
  4. Avatar for kukukodama 144. kukukodama Lv 1 1 pt. 8,372
  5. Avatar for Kalimo 203 145. Kalimo 203 Lv 1 1 pt. 7,745
  6. Avatar for jflat06 147. jflat06 Lv 1 1 pt. 3,046
  7. Avatar for Simek 148. Simek Lv 1 1 pt. 2,966
  8. Avatar for JMStiffler 149. JMStiffler Lv 1 1 pt. 2,966
  9. Avatar for Ssanderr4 150. Ssanderr4 Lv 1 1 pt. 2,966

Comments