Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for anaserra 121. anaserra Lv 1 1 pt. 5,956
  2. Avatar for may of rose 122. may of rose Lv 1 1 pt. 5,682
  3. Avatar for DeedoFeedo 123. DeedoFeedo Lv 1 1 pt. 5,665
  4. Avatar for madiseno21 124. madiseno21 Lv 1 1 pt. 5,635
  5. Avatar for doctaven 125. doctaven Lv 1 1 pt. 5,048
  6. Avatar for kingdiamonds 126. kingdiamonds Lv 1 1 pt. 3,025
  7. Avatar for atlas100 127. atlas100 Lv 1 1 pt. 0
  8. Avatar for hpaege 128. hpaege Lv 1 1 pt. 0
  9. Avatar for Museka 129. Museka Lv 1 1 pt. 0
  10. Avatar for Hollinas 130. Hollinas Lv 1 1 pt. 0

Comments