Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for andit 131. andit Lv 1 1 pt. 0
  2. Avatar for Threeoak 132. Threeoak Lv 1 1 pt. 0
  3. Avatar for Pavel1940 133. Pavel1940 Lv 1 1 pt. 0
  4. Avatar for jerry78424 134. jerry78424 Lv 1 1 pt. 0
  5. Avatar for lamoille 135. lamoille Lv 1 1 pt. 0
  6. Avatar for joshmiller 136. joshmiller Lv 1 1 pt. 0
  7. Avatar for atlas100 137. atlas100 Lv 1 1 pt. 0
  8. Avatar for hpaege 138. hpaege Lv 1 1 pt. 0
  9. Avatar for Hollinas 139. Hollinas Lv 1 1 pt. 0

Comments