Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  6. Avatar for Team China 17. Team China 1 pt. 0

  1. Avatar for Kevin76 132. Kevin76 Lv 1 1 pt. 0
  2. Avatar for Uttkarshtest 133. Uttkarshtest Lv 1 1 pt. 0
  3. Avatar for andit 134. andit Lv 1 1 pt. 0
  4. Avatar for Threeoak 135. Threeoak Lv 1 1 pt. 0
  5. Avatar for Pavel1940 136. Pavel1940 Lv 1 1 pt. 0
  6. Avatar for jerry78424 137. jerry78424 Lv 1 1 pt. 0
  7. Avatar for lamoille 138. lamoille Lv 1 1 pt. 0
  8. Avatar for joshmiller 139. joshmiller Lv 1 1 pt. 0

Comments