Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  6. Avatar for Team China 17. Team China 1 pt. 0

  1. Avatar for retiredmichael 11. retiredmichael Lv 1 69 pts. 10,492
  2. Avatar for pauldunn 12. pauldunn Lv 1 67 pts. 10,481
  3. Avatar for robgee 13. robgee Lv 1 64 pts. 10,477
  4. Avatar for phi16 14. phi16 Lv 1 61 pts. 10,442
  5. Avatar for AtOneMent 15. AtOneMent Lv 1 59 pts. 10,420
  6. Avatar for grogar7 16. grogar7 Lv 1 57 pts. 10,395
  7. Avatar for ZeroLeak7 17. ZeroLeak7 Lv 1 55 pts. 10,383
  8. Avatar for khalan.ysatis 18. khalan.ysatis Lv 1 52 pts. 10,356
  9. Avatar for frood66 19. frood66 Lv 1 50 pts. 10,353
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 48 pts. 10,341

Comments