Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for Mike Cassidy 31. Mike Cassidy Lv 1 30 pts. 10,157
  2. Avatar for uihcv 32. uihcv Lv 1 29 pts. 10,151
  3. Avatar for drjr 33. drjr Lv 1 27 pts. 10,094
  4. Avatar for Blipperman 34. Blipperman Lv 1 26 pts. 10,085
  5. Avatar for guineapig 35. guineapig Lv 1 25 pts. 10,066
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 24 pts. 10,062
  7. Avatar for heather-1 37. heather-1 Lv 1 23 pts. 10,031
  8. Avatar for YeshuaLives 38. YeshuaLives Lv 1 21 pts. 10,028
  9. Avatar for johnmitch 39. johnmitch Lv 1 20 pts. 9,997
  10. Avatar for alcor29 40. alcor29 Lv 1 20 pts. 9,930

Comments