Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for joremen 41. joremen Lv 1 19 pts. 9,926
  2. Avatar for Flagg65a 42. Flagg65a Lv 1 18 pts. 9,855
  3. Avatar for diamonddays 43. diamonddays Lv 1 17 pts. 9,834
  4. Avatar for Steven Pletsch 44. Steven Pletsch Lv 1 16 pts. 9,831
  5. Avatar for SaraL 45. SaraL Lv 1 15 pts. 9,829
  6. Avatar for boondog 46. boondog Lv 1 14 pts. 9,820
  7. Avatar for Deleted player 47. Deleted player pts. 9,807
  8. Avatar for YGK 48. YGK Lv 1 13 pts. 9,791
  9. Avatar for andrewtmaxwell 49. andrewtmaxwell Lv 1 12 pts. 9,779
  10. Avatar for jausmh 50. jausmh Lv 1 12 pts. 9,774

Comments