Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for cinnamonkitty 81. cinnamonkitty Lv 1 2 pts. 9,005
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 2 pts. 9,004
  3. Avatar for Merf 83. Merf Lv 1 2 pts. 8,979
  4. Avatar for antibot215 84. antibot215 Lv 1 2 pts. 8,958
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 1 pt. 8,946
  6. Avatar for navn 86. navn Lv 1 1 pt. 8,932
  7. Avatar for hada 87. hada Lv 1 1 pt. 8,927
  8. Avatar for gurch 88. gurch Lv 1 1 pt. 8,844
  9. Avatar for Vincera 89. Vincera Lv 1 1 pt. 8,797
  10. Avatar for stomjoh 90. stomjoh Lv 1 1 pt. 8,726

Comments