Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075
  1. Avatar for khalan.ysatis 21. khalan.ysatis Lv 1 50 pts. 10,480
  2. Avatar for phi16 22. phi16 Lv 1 48 pts. 10,478
  3. Avatar for robgee 23. robgee Lv 1 46 pts. 10,474
  4. Avatar for altejoh 24. altejoh Lv 1 44 pts. 10,472
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 43 pts. 10,453
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 41 pts. 10,450
  7. Avatar for Merf 27. Merf Lv 1 39 pts. 10,447
  8. Avatar for weitzen 28. weitzen Lv 1 38 pts. 10,438
  9. Avatar for dam_01 29. dam_01 Lv 1 36 pts. 10,435
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 35 pts. 10,426

Comments