Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075
  1. Avatar for grogar7 61. grogar7 Lv 1 8 pts. 10,143
  2. Avatar for ourtown 62. ourtown Lv 1 8 pts. 10,129
  3. Avatar for Bletchley Park 63. Bletchley Park Lv 1 8 pts. 10,102
  4. Avatar for diamonddays 64. diamonddays Lv 1 7 pts. 10,082
  5. Avatar for JasperD 65. JasperD Lv 1 7 pts. 10,075
  6. Avatar for mitarcher 66. mitarcher Lv 1 6 pts. 10,066
  7. Avatar for tarimo 67. tarimo Lv 1 6 pts. 10,063
  8. Avatar for alwen 68. alwen Lv 1 6 pts. 10,054
  9. Avatar for stomjoh 69. stomjoh Lv 1 6 pts. 10,053
  10. Avatar for WBarme1234 70. WBarme1234 Lv 1 5 pts. 10,042

Comments