Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075
  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 34 pts. 10,425
  2. Avatar for O Seki To 32. O Seki To Lv 1 32 pts. 10,423
  3. Avatar for eusair 33. eusair Lv 1 31 pts. 10,422
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 30 pts. 10,416
  5. Avatar for nicobul 35. nicobul Lv 1 28 pts. 10,413
  6. Avatar for Threeoak 36. Threeoak Lv 1 27 pts. 10,412
  7. Avatar for hpaege 37. hpaege Lv 1 26 pts. 10,411
  8. Avatar for ZeroLeak7 38. ZeroLeak7 Lv 1 25 pts. 10,408
  9. Avatar for guineapig 39. guineapig Lv 1 24 pts. 10,386
  10. Avatar for sciencewalker 40. sciencewalker Lv 1 23 pts. 10,385

Comments