Placeholder image of a protein
Icon representing a puzzle

1529: Revisiting Puzzle 68: Bos Taurus

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 03, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,751
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,749
  3. Avatar for Go Science 3. Go Science 56 pts. 10,730
  4. Avatar for Contenders 4. Contenders 41 pts. 10,652
  5. Avatar for Void Crushers 5. Void Crushers 29 pts. 10,650
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 10,507
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,507
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 10,484
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 10,423
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 10,075
  1. Avatar for toshiue 71. toshiue Lv 1 5 pts. 10,023
  2. Avatar for Jesse Pinkman 72. Jesse Pinkman Lv 1 5 pts. 10,015
  3. Avatar for gurch 73. gurch Lv 1 4 pts. 10,009
  4. Avatar for pfirth 74. pfirth Lv 1 4 pts. 10,004
  5. Avatar for alcor29 75. alcor29 Lv 1 4 pts. 9,997
  6. Avatar for Altercomp 76. Altercomp Lv 1 4 pts. 9,986
  7. Avatar for cobaltteal 77. cobaltteal Lv 1 4 pts. 9,986
  8. Avatar for Deleted player 78. Deleted player pts. 9,978
  9. Avatar for yoyoparis 79. yoyoparis Lv 1 3 pts. 9,950
  10. Avatar for frostschutz 80. frostschutz Lv 1 3 pts. 9,929

Comments