Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for SaraL 91. SaraL Lv 1 1 pt. 9,149
  2. Avatar for Auntecedent 92. Auntecedent Lv 1 1 pt. 9,128
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 1 pt. 9,123
  4. Avatar for GaryForbis 94. GaryForbis Lv 1 1 pt. 9,106
  5. Avatar for Deleted player 95. Deleted player pts. 9,106
  6. Avatar for alrianne 96. alrianne Lv 1 1 pt. 9,102
  7. Avatar for Arne Heessels 97. Arne Heessels Lv 1 1 pt. 9,099
  8. Avatar for jebbiek 98. jebbiek Lv 1 1 pt. 9,075
  9. Avatar for fwadwani 99. fwadwani Lv 1 1 pt. 9,060
  10. Avatar for SouperGenious 100. SouperGenious Lv 1 1 pt. 9,040

Comments