Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  2. Avatar for Deleted group 13. Deleted group pts. 9,060
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  4. Avatar for freefolder 15. freefolder 1 pt. 8,776
  5. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731

  1. Avatar for Superphosphate 131. Superphosphate Lv 1 1 pt. 8,298
  2. Avatar for ivalnic 132. ivalnic Lv 1 1 pt. 8,140
  3. Avatar for TotallyNotRobot 133. TotallyNotRobot Lv 1 1 pt. 8,075
  4. Avatar for weegeehater 134. weegeehater Lv 1 1 pt. 7,846
  5. Avatar for polymorphicchanges 135. polymorphicchanges Lv 1 1 pt. 7,844
  6. Avatar for kkaaggii 136. kkaaggii Lv 1 1 pt. 7,738
  7. Avatar for phi16 137. phi16 Lv 1 1 pt. 7,293
  8. Avatar for 01010011111 138. 01010011111 Lv 1 1 pt. 7,033
  9. Avatar for Felix12356 139. Felix12356 Lv 1 1 pt. 6,975
  10. Avatar for altejoh 140. altejoh Lv 1 1 pt. 2,692

Comments