Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  2. Avatar for Deleted group 13. Deleted group pts. 9,060
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  4. Avatar for freefolder 15. freefolder 1 pt. 8,776
  5. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731

  1. Avatar for TastyMunchies 21. TastyMunchies Lv 1 47 pts. 10,557
  2. Avatar for tarimo 22. tarimo Lv 1 45 pts. 10,540
  3. Avatar for grogar7 23. grogar7 Lv 1 44 pts. 10,537
  4. Avatar for alwen 24. alwen Lv 1 42 pts. 10,533
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 40 pts. 10,473
  6. Avatar for joremen 26. joremen Lv 1 38 pts. 10,462
  7. Avatar for Deleted player 27. Deleted player pts. 10,450
  8. Avatar for isaksson 28. isaksson Lv 1 35 pts. 10,446
  9. Avatar for diamonddays 29. diamonddays Lv 1 34 pts. 10,442
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 32 pts. 10,428

Comments