Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for Blipperman 31. Blipperman Lv 1 31 pts. 10,426
  2. Avatar for MicElephant 32. MicElephant Lv 1 30 pts. 10,412
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 28 pts. 10,407
  4. Avatar for toshiue 34. toshiue Lv 1 27 pts. 10,372
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 26 pts. 10,364
  6. Avatar for stomjoh 36. stomjoh Lv 1 25 pts. 10,359
  7. Avatar for gdnskye 37. gdnskye Lv 1 24 pts. 10,314
  8. Avatar for Vinara 38. Vinara Lv 1 23 pts. 10,290
  9. Avatar for manu8170 39. manu8170 Lv 1 22 pts. 10,276
  10. Avatar for robgee 40. robgee Lv 1 21 pts. 10,260

Comments