Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  2. Avatar for Deleted group 13. Deleted group pts. 9,060
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  4. Avatar for freefolder 15. freefolder 1 pt. 8,776
  5. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731

  1. Avatar for katling 41. katling Lv 1 20 pts. 10,253
  2. Avatar for khalan.ysatis 42. khalan.ysatis Lv 1 19 pts. 10,174
  3. Avatar for DoctorSockrates 43. DoctorSockrates Lv 1 18 pts. 10,151
  4. Avatar for pfirth 44. pfirth Lv 1 17 pts. 10,125
  5. Avatar for Crossed Sticks 45. Crossed Sticks Lv 1 16 pts. 10,104
  6. Avatar for ViJay7019 46. ViJay7019 Lv 1 15 pts. 10,009
  7. Avatar for cobaltteal 47. cobaltteal Lv 1 15 pts. 9,971
  8. Avatar for smilingone 48. smilingone Lv 1 14 pts. 9,933
  9. Avatar for guineapig 49. guineapig Lv 1 13 pts. 9,928
  10. Avatar for O Seki To 50. O Seki To Lv 1 13 pts. 9,885

Comments