Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for drjr 51. drjr Lv 1 12 pts. 9,876
  2. Avatar for ManVsYard 52. ManVsYard Lv 1 11 pts. 9,806
  3. Avatar for sciencewalker 53. sciencewalker Lv 1 11 pts. 9,764
  4. Avatar for ourtown 54. ourtown Lv 1 10 pts. 9,738
  5. Avatar for andrewxc 55. andrewxc Lv 1 10 pts. 9,726
  6. Avatar for joaniegirl 56. joaniegirl Lv 1 9 pts. 9,705
  7. Avatar for Jesse Pinkman 57. Jesse Pinkman Lv 1 9 pts. 9,686
  8. Avatar for jobo0502 58. jobo0502 Lv 1 8 pts. 9,685
  9. Avatar for jausmh 59. jausmh Lv 1 8 pts. 9,680
  10. Avatar for alcor29 60. alcor29 Lv 1 7 pts. 9,655

Comments