Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for atimeswift 61. atimeswift Lv 1 7 pts. 9,654
  2. Avatar for rabamino12358 62. rabamino12358 Lv 1 7 pts. 9,644
  3. Avatar for uihcv 63. uihcv Lv 1 6 pts. 9,587
  4. Avatar for RootBeerSwordsman 64. RootBeerSwordsman Lv 1 6 pts. 9,569
  5. Avatar for alyssa_d 65. alyssa_d Lv 1 6 pts. 9,512
  6. Avatar for carsonfb 66. carsonfb Lv 1 5 pts. 9,510
  7. Avatar for dam_01 67. dam_01 Lv 1 5 pts. 9,509
  8. Avatar for Deleted player 68. Deleted player pts. 9,493
  9. Avatar for froggs554 69. froggs554 Lv 1 4 pts. 9,493
  10. Avatar for Merf 70. Merf Lv 1 4 pts. 9,485

Comments