Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for erikviking 71. erikviking Lv 1 4 pts. 9,475
  2. Avatar for dbuske 72. dbuske Lv 1 4 pts. 9,440
  3. Avatar for Vincera 73. Vincera Lv 1 3 pts. 9,439
  4. Avatar for weitzen 74. weitzen Lv 1 3 pts. 9,410
  5. Avatar for rezaefar 75. rezaefar Lv 1 3 pts. 9,396
  6. Avatar for hada 76. hada Lv 1 3 pts. 9,384
  7. Avatar for atlas100 77. atlas100 Lv 1 3 pts. 9,368
  8. Avatar for mitarcher 78. mitarcher Lv 1 3 pts. 9,338
  9. Avatar for yoyoparis 79. yoyoparis Lv 1 2 pts. 9,335
  10. Avatar for Knoblerine 80. Knoblerine Lv 1 2 pts. 9,332

Comments