Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,884
  2. Avatar for Contenders 2. Contenders 73 pts. 10,836
  3. Avatar for Go Science 3. Go Science 52 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,758
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 10,722
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,658
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 10,654
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,573
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,885
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,512
  1. Avatar for Anamfija 111. Anamfija Lv 1 1 pt. 8,884
  2. Avatar for Museka 112. Museka Lv 1 1 pt. 8,862
  3. Avatar for momadoc 113. momadoc Lv 1 1 pt. 8,834
  4. Avatar for Mizraim 114. Mizraim Lv 1 1 pt. 8,796
  5. Avatar for Altercomp 115. Altercomp Lv 1 1 pt. 8,776
  6. Avatar for JellyJump 116. JellyJump Lv 1 1 pt. 8,771
  7. Avatar for Bithalbierer 117. Bithalbierer Lv 1 1 pt. 8,758
  8. Avatar for Psych0Active 118. Psych0Active Lv 1 1 pt. 8,745
  9. Avatar for doctaven 119. doctaven Lv 1 1 pt. 8,731
  10. Avatar for dudegirl3 120. dudegirl3 Lv 1 1 pt. 8,724

Comments