Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,884
  2. Avatar for Contenders 2. Contenders 73 pts. 10,836
  3. Avatar for Go Science 3. Go Science 52 pts. 10,776
  4. Avatar for Marvin's bunch 4. Marvin's bunch 36 pts. 10,758
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 10,722
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,658
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 10,654
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,573
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,885
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 9,512
  1. Avatar for nathanmills 81. nathanmills Lv 1 2 pts. 9,302
  2. Avatar for kludbrook 82. kludbrook Lv 1 2 pts. 9,276
  3. Avatar for silent gene 83. silent gene Lv 1 2 pts. 9,268
  4. Avatar for anaserra 84. anaserra Lv 1 2 pts. 9,246
  5. Avatar for JasperD 85. JasperD Lv 1 2 pts. 9,242
  6. Avatar for hengoedja 86. hengoedja Lv 1 2 pts. 9,241
  7. Avatar for cherry39 87. cherry39 Lv 1 1 pt. 9,227
  8. Avatar for rinze 88. rinze Lv 1 1 pt. 9,206
  9. Avatar for NotJim99 89. NotJim99 Lv 1 1 pt. 9,155
  10. Avatar for multaq 90. multaq Lv 1 1 pt. 9,153

Comments